PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016432254.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 270aa    MW: 30079.8 Da    PI: 10.4454
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016432254.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.3e-1476120347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
   XP_016432254.1  76 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 120
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.83669125IPR017930Myb domain
SuperFamilySSF466893.59E-1771126IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-1772123IPR006447Myb domain, plants
SMARTSM007171.8E-1073123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1175120IPR009057Homeodomain-like
PfamPF002491.5E-1176120IPR001005SANT/Myb domain
CDDcd001671.22E-976121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MSNDCGNKEH ELQSKGFMLF GVRVIEGGTC FRKSASMNNL VLFEQQQQDS NVAAGYASDD  60
VVHPSARSRE RKRGVPWTEE EHKLFLLGLQ KVGKGDWRGI SRNFVKTRTP TQVASHAQKY  120
FLRRNNTNNR RRRRSSLFDI TTHTVQTVAK LEDKQMNQNT IEKFPMSAFE QAKLSGNCES  180
STNNLMIGLN KSVKPIRSIP FLPVPPSSKM ENLNLNKTYD QESSPLSLKL STSTSSSDEK  240
SPPARHSSGF QAMSSGFNGN TSGDSIISVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2128054e-45AC212805.1 Populus trichocarpa clone POP033-J14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592875.10.0PREDICTED: transcription factor MYB1R1-like
RefseqXP_016432254.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B04e-42MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLK4BNB61e-105K4BNB6_SOLLC; Uncharacterized protein
STRINGSolyc04g005100.2.11e-104(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114232225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-56MYB_related family protein